PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_09009
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family GATA
Protein Properties Length: 146aa    MW: 16598.2 Da    PI: 10.2877
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_09009genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.92.8e-1872106135
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                 C++C + kTp+WR gp g+ktLCnaCG+++++ +l
  PEQU_09009  72 CTHCLSQKTPQWRAGPLGPKTLCNACGVRFKSGRL 106
                 *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.26666102IPR000679Zinc finger, GATA-type
SMARTSM004018.4E-1566120IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.71E-1468130No hitNo description
Gene3DG3DSA:3.30.50.105.4E-1470104IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.09E-1271128No hitNo description
PfamPF003205.2E-1672106IPR000679Zinc finger, GATA-type
PROSITE patternPS0034407297IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MKFSTKTKTK RRKLAPLEEE NTPLLPQTYW LAESELILPK KDFYENNKAK TTEVEAQAVP  60
GKDQGQVQPR KCTHCLSQKT PQWRAGPLGP KTLCNACGVR FKSGRLLPEY RPAKSPTFVS  120
CKHSNSHKKV MEMRMAIPSN HFGLED
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010910788.18e-57PREDICTED: GATA transcription factor 2-like
TrEMBLA0A067KXQ63e-50A0A067KXQ6_JATCU; Uncharacterized protein
STRINGPOPTR_0013s05610.12e-49(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.13e-37GATA transcription factor 2